- Home
-
Catalog Peptides
- Adreno corticotropic Hormones (ACTH)
- Amylins
- Anti-Inflammatory Peptides
- Antibiotic Peptides
- Antimicrobial Peptides
- Aspartame and Related Asp-Phe Dipeptides
- beta-Amyloids and Related Peptides
- C-Peptides
- Calcium-Like Peptides
- Cosmetic Peptides
- Delta-Sleep Inducing Peptide (DSIP) and Analogs
- Gastric Inhibitory Peptides
- Gastrins
- GHRELINS
- GHRF's
- Glucagons
- Growth Factors and Fragments
- Insulin-Like Growth Factors (IGF)
- Kisspeptin Peptides
- Leptin Fragment Peptides
- LHRH and Analogs
- LL-37 and Fragments
- Mating Factors
- Melanin-Concentrating Hormones (MCH)
- Melanocyte Stimulating Hormones (MSH)
- Melanoma Peptides
- Mitochondrial Peptides
- Miscellaneous Peptides
- Neuropeptide
- Peptide Standards
- Peptides YY
- PhosphoPeptides
- Prolactin Releasing Peptides
- Protein Phosphorylation Peptides
- Thymopoietin and Thymosin Peptides
- Virus Related Peptides
- Chemicals & Kits
-
Laboratory Supply
- Microscopes, Cameras & Parts
- Glassware
- Equipment
- Plasticware
- Autoclave & Sampling Bags
- Cell Strainers
- Centrifuge Tubes
- Culture Tubes
- Disposable Transfer Pipettes
- Disposable Weigh Boats
- Flow Cytometry Tubes
- Innoculating Loops & Spreaders
- Microcentrifuge Tubes
- PCR Tubes, Plates & Membranes
- Screw Cap Tubes
- Solution Reservoirs
- Storage Racks & Boxes
- Western Blotting Boxes
- Western Blotting Film
- Hydrometers
- Porcelain
- Refractometers and Polarimeters
- Temperature
- Services
- Resources
- TERMS OF SALE
A World Leader in Peptide Synthesis & Lyophilization
CanadaPeptide.com A World Leader in Peptide Synthesis & Lyophilization
(514) 613 0811CONTACT US
0item(s)
You have no items in your shopping cart.
Details
Follistatin 344 |
Manufactured in Canada. HPLC and Mass Spectro available upon request.
Additional Information
| Catalog ID | FS3 |
|---|---|
| Sequence | GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCI PCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKAR CKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSL CDELCPDSKSD |
| Synonyms | No |
| Purity | >95% |
| Molecular Formula | C121H200N42O39 |
| Molecular Weight | 2888.16 |
| Appearance | White lyophilized (freeze-dried) powder |
This lyophilized preparation is stable at room temperature when garded from light, but should be kept at -20°C for long term storage, preferably with dessicant. Upon reconstitution, the preparation is stable when stored at 2-8°C. For maximum stability, apportion the reconstituted preparation into working aliquots and store at -20°C. Avoid repeat freeze/thaw cycles.
Canadian Dollars
All prices are in $CAD
Quotes
You have no items in your quote.
Contact Information
-
Office Hours:
Mon - Fri / 10:00AM - 4:00PM EST -
Phone:
(514) 613-0811 -
Email:
[email protected]
Quick Links
Sign Up to the Newsletter!
