(514) 613 0811CONTACT US
0item(s)

You have no items in your shopping cart.

Product was successfully added to your shopping cart.

Follistatin 344 1mg

Quick Overview

All products and services provided by Canada Peptide are to be used explicitly for laboratory and academic research.

None of the products or services we provide on this site are to be ingested or used on humans, animals or any therapeutic uses.

Customers must comply with the Terms of Sale.

Availability: In stock

$98.99
Reward Points Policy You will earn 1 Peptide Points for buying this product.

Details

Follistatin 344

Quantity: 1 MG
Purity: >95% by HPLC
Appearance: Sterile filtered white lyophilized (freeze-dried) powder


Manufactured in Canada by cGMP & ISO:9001 Certified Facility HPLC and Mass Spectro available upon request.

Additional Information

Sequence GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCI PCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKAR CKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSL CDELCPDSKSD
Purity >95%
Quantity 1 MG
Molecular Formula C121H200N42O39
Molecular Weight 2888.16

This lyophilized preparation is stable at room temperature when garded from light, but should be kept at -20°C for long term storage, preferably with dessicant.

Upon reconstitution, the preparation is stable when stored at 2-8°C.

For maximum stability, apportion the reconstituted preparation into working aliquots and store at -20°C.

Avoid repeat freeze/thaw cycles.

We recommend that this vial be briefly centrifuged prior to opening to settle the contents to the bottom.

Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

Stock solutions should be apportioned into working aliquots and stored at < -20°C.

Further dilutions should be made in appropriate buffered solutions.