ACVR2B (ACE-031) 1mg

ACVR2B (ACE-031) 1mg

Reward Points Policy You will earn 1 Peptide Points for buying this product.
$169.99

Availability: In stock

SKU: AC1

All products and services provided by Canada Peptide are to be used explicitly for laboratory and academic research.

None of the products or services we provide on this site are to be ingested or used on humans, animals or any therapeutic uses.

Customers must comply with the Terms of Sale.
Qty

ACVR2B

Quantity:1mg
Purity:>95% by HPLC
Appearance:Sterile filtered white lyophilized (freeze-dried) powder
AA Sequence:MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to settle the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
Storage:This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably with dessicant. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximum stability, apportion the reconstituted preparation into working aliquots and store at -20°C. Avoid repeat freeze/thaw cycles.


Manufactured in Canada by cGMP & ISO:9001 Certified Facility
HPLC and Mass Spectro available upon request.